Large PrintHandheldAudioRating
Twisting The Hellmouth Crossing Over Awards - Results
Is your email address still valid?

Author PatriciaLouise


Recent entries from Patricia's Fanfiction Shelf - the blog of PatriciaLouise

NOTE: This blog has been rated FR18 by the author. Blog content is not moderated by TtH

Title: Fixing It
Author: Patriciatepes
Fandom: Harry Potter
Rating: PG
Pairing/Characters: Harry, Hermione, Voldemort (in a way)
Summary: The Dark Lord was supposed to be dead, and that he was… but this was not what anyone expected. Not at all. And the mystery was taking its toll on Hermione.
Word Count: ~1300
Original Prompt: 177. Harry Potter - any characters - Harry might have killed Voldemort for good this time, but the spell that killed him had a very unintended side-effect.
Author's Note: This is for the bonus round of Illustrationzombi_fic_ation 2013. I'm also using this to fill my headache/migraine square for Illustrationhc_bingo. I hope everyone enjoys!

Fixing It

Hermione rubbed her forehead, staring down from the catwalk into the glass wall—huge window, really—just below. She just didn't understand it. Nothing about it made sense, no matter how she looked at. Neither muggle medical knowledge nor wizarding magic had revealed any great reasoning of the situation to her. In a word, she was stuck.

The sound of footsteps on the metal stairs behind her should have made her turn. But she remained, staring eternally down into that room with the glass wall. She didn't have to turn. She knew who was approaching.

"I can't figure it, Harry," she said, as soon as The Boy Who Lived reached her. "I've tried ev...
Posted: 21 Oct 13 20:14 • More • Comments
cvhctrappedbetweenrealitiesAuthor: Patriciatepes
Title: In Between
Fandom: Castlevania
Prompt: Trapped between realities
Medium: Art; wallpaper
Wordcount: N/A
Rating: G
Warnings: N/A
Summary: Done for my 2013 Illustrationhc_bingo card square, trapped between realities. Basically, I'm using the concept of Alucard being the half-blooded vampire that he is. The comfort eventually coming in the form of the love he has known, despite the darkness within him.
Disclaimer: I don't own Castlevania or the images used here. I used a fiery texture from Muffet1 and the mosaic texture from Chamberstock and the brush used was by Ewanism
Posted: 30 Sep 13 21:13 • Comments
Author Name: Patriciatepes (Patricia de Lioncourt )

Fandom: Supernatural

Rating: PG-13 (for Now)

Characters: Daphne Allen, Crowley, Castiel, Meg, Dean, Sam, Kevin Tran, and necessary OCs

Pairing: Crowley/Daphne, Castiel/Meg, past Daphne/Castiel

Chapter Links: Prev | Next

Warnings: Hints of torture, sexual situations, light torture… more might be added later depending on how dark I want to take this

Summary: AU Past Parts of SPN S8. Daphne Allen is a saint… and saints are rare creatures. Saints have many powers, useful to both angels… and to demons. Saints can hear the angels speak, their blood can be used for many things, and they have a sight for things that normal humans do not. And, more importantly, saints have the power to redeem a soul. In order to ensure her family's safety, Daphne makes a deal with Crowley—one year of usage of her saintly powers with no arguments, and no interferences.

Disclaimer: I don't own Supernatural or any related characters. They belong to Kripke. No money made here.

Author's Notes: Just a couple of things here right off the bat. First off, I will have multiple points of view. However, for the majority of the fic, it will be through Daphne's eyes. Also, I did a Hard R-rated fic that had a similar setting to this one… what can I say? I just love this setting. But I'll be spanning this one's view out a little bit more. Also, I know this chapter is a bit long… but I had to cover the flashback. I know that it could've been a story in and of itself, but I feel that the rest of this story is the more interesting bit. And the rating may rise in later chapters.  Also, I'm still way behind on posting things here on LJ... I...
Posted: 22 Sep 13 22:35 • More • Comments
Title: Nobody Here But Us Humans
Author: Patriciatepes
Fandom: Supernatural
Rating: PG
Pairing/Characters: Meg/Castiel, Sam, Dean
Summary: Post SPN S8. Meg considers finally telling Castiel about how she feels… as she hangs out outside his door.
Word Count: ~1700
Author's Note: This was written as a prize fic for Illustrationof_nightingales for her 2nd place win over at Illustrationspnpairingbingo. I hope she enjoys what I've written for her! And I apologize for the wait. I had a great time writing this!


Nobody Here But Us Humans

Neither one of them really liked being so… useless. Maybe that was because they had never really been truly useless. Both had always had a purpose, a mission. But, now that Meg sat there at the table, staring on as Dean explained the plot of Who Framed Roger Rabbit? to a very perplexed Castiel while Sam chuckled—and tried to hide it—she thought about how neither one of them had really liked being dead either.

It had been a year, just about, since her own personal death, facing off with that smarmy dick, Crowley. One year since she had had that heart-to-heart with Sam outside Lucifer's Crypt… one year since she ...
Posted: 18 Sep 13 21:04 • More • Comments
So, I think Illustrationtwisted_slinky has probably sung this from this rooftops here on LJ, lol, but if anyone out there is wondering why I've seemed to have disappeared from the face of the planet--i.e. haven't turned in any challenges stuff in a while--it's because on Aug. 29th, I gave birth to my son--and my first child--Connor.  I'm so super excited to be a mom--and sometimes, I still can't believe it.  But, during the labor, my son--in his eagerness to join the world--tore out of me... literally.  I bled a lot, so much so that my husband got pretty scared that he was going to lose me.  I was kept an extra day in the hospital so they could give me a blood transfusion and try to get my cell count up.  When it evened out--still low, but didn't lower--they let me out, but I'm now on an iron supplement that I have to take twice a day.

And as if that wasn't enough to tire me out, I also have a newborn, lol.  So, sleep feels like this to me lately:


And, furthermore, starting about two weeks before I gave birth, I began to have a bad flare up in my already-existing carpal tunnel, and had a Novocaine-like numbness in my thumb, index finger, and middle finger of my left hand.  It continues, and I'm really hoping that it'll go away soon enough.  As I typed elsewhere today, just writing this journal is requiring a level of concentration that I haven't had to use since I first started to learn how to type.  So writing's a bit like Dean_i_cant
But I haven't forgotten about my chal...
Posted: 10 Sep 13 10:18 • More • Comments
Yes, I know I'm one of the mods.  Yes, I know that I'm not doing this for anything but more fandom writing.  Yes, I know I still have to complete an amnesty bingo off my original SPN pairing card... but damn it, if this Crossover Challenge doesn't sound like fun!  See this post on Illustrationspnpairingbingo if you'd like to play along!  Here's my square!

Crowley Anna Kevin Meg
Posted: 10 Jul 13 18:07 • Comments
Title: Venom
Author: Patriciatepes
Fandom: Harry Potter
Characters/Pairings: Snape/Hermione
Length: 2,582
Rating: PG
Spoilers: Post Deathly Hallows, slightly AU
Warnings: None
Prompt: 172. Harry Potter - Snape/ Hermione - Nagini's bite didn't entirely kill Snape. But how can she remove the curse without making his death permanent?
Summary: Hermione knew that Nagini's bite wasn't the end… at least, not yet it wasn't.
Disclaimer: I don't own Harry Potter or any related character.
Author's Note: I really hope that whomever wrote this prompt likes what I've given them. I adore this ship, but I'm afraid I didn't get to the shippy-ness enough… if that makes sense. Even still, I still hope it's a good story that you can all enjoy! Written for zombi-fic-ation 2013 and for my Illustrationhc_bingo, severe/life-threatening illness. Also, I'm a day late posting this, and I apologize. I'm 31 weeks pregnant and my stomach decided it was going to explode on me. Not pretty.


Ron and Harry didn't understand. They hadn't studied like she had studied. When Nagini had bitten Severus Snape, both the boys had labeled him as dead and gone. And Hermione had gone along with it, even helping Harry gather Snape's memories. But, once Voldemort was dead, once Hermione had shared her moment with Ron, she had snuck away. The sun was rising, and it was brighter than Hermione had ever thought she'd seen it before. Lips pursed, she made her way back to Severus Snape's all but forgotten body.

Harry, in the briefest o...
Posted: 26 Jun 13 09:25 • More • Comments
Title: Following the Trends
Author: Patriciatepes
Fandom: Buffy the Vampire Slayer
Characters/Pairings: Spike, Buffy, Angel
Length: 1,639
Rating: PG-13
Spoilers: Post Buffy and Angel's final seasons… doesn't follow the comics, save for a few ideas plucked here and there.
Warnings: Light zombie-related violence
Prompt: 080. Buffy the Vampire Slayer - Spike/any or gen - vampires vs zombies. It's a messy old world.
Summary: When Buffy and Angel went to find where, exactly, Spike had gotten to for the last year or so… this was the last thing they expected.
Author's Note: This story is just meant to be a funny little thing, written for Illustrationzombi_fic_ation 2013.  Actually, I sort of, accidentally, chose the same two fandoms to write for as I did last year... and accidentally did the same genre for said fandoms as I did the year before.  Life's funny like that, huh?  Hope you enjoy!

Following the Trends

"You've gotta be freakin' kidding me," Buffy huffed from her place in the stands.

Well, "stands" was a bit liberal. Sure, it was shaped like a stadium, but Buffy had a sneaking suspicion that the former construction area was meant to be a bit more than this. As it was, they were high above a coliseum-like ring, high fencing topped with barbed wire the audience's only protection against the action about to begin on the dirt-covered ground below. Granted, Buffy was about ninety-percent sure that the audience could've probably held their own… but an effort to keep them separate from ...
Posted: 22 Jun 13 20:26 • More • Comments
So, over at Illustrationspnpairingbingo, we had a tie for third place.  Winners got to choose between points, a fic, or an art prize, and Illustrationsmalltrolven wanted art for one of her stories.  So I hope she likes the banner I did for her Jody/Bobby story--which was great.  Go read.


<img src="">

I put the text box up in case you wanted ease of posting.  Just be sure to copy/paste the coding in the box to the HTML editor on your journal entry or wherever you want to use your banner, Illustrationsmalltrolven.  Hope you liked it, and congrats again for placing!
Posted: 21 Jun 13 10:38 • Comments
Author Name: Patriciatepes (Patricia de Lioncourt )

Fandom: Supernatural

Rating: PG-13 (for Now)

Characters: Daphne Allen, Crowley, Castiel, Meg, Dean, Sam, Kevin Tran, and necessary OCs

Pairing: Crowley/Daphne, Castiel/Meg, past Daphne/Castiel

Chapter Links: Prev | Next

Warnings: Hints of torture, sexual situations, light torture… more might be added later depending on how dark I want to take this

Summary: AU Past Parts of SPN S8. Daphne Allen is a saint… and saints are rare creatures. Saints have many powers, useful to both angels… and to demons. Saints can hear the angels speak, their blood can be used for many things, and they have a sight for things that normal humans do not. And, more importantly, saints have the power to redeem a soul. In order to ensure her family's safety, Daphne makes a deal with Crowley—one year of usage of her saintly powers with no arguments, and no interferences.

Disclaimer: I don't own Supernatural or any related characters. They belong to Kripke. No money made here.

Author's Notes: Just a couple of things here right off the bat. First off, I will have multiple points of view. However, for the majority of the fic, it will be through Daphne's eyes. Also, I did a Hard R-rated fic that had a similar setting to this one… what can I say? I just love this setting. But I'll be spanning this one's view out a little bit more. Also, I know this chapter is a bit long… but I had to cover the flashback. I know that it could've been a story in and of itself, but I feel that the rest of this story is the more interesting bit. And the rating may rise in later chapters....
Posted: 18 Jun 13 15:18 • More • Comments
Okay, so over at Illustrationspn_bigpretzel this past weekend, we had a great drabble challenge.  Team White Hats (the heroes) vs. Team Black Hats (the villains).  Anyone really wondering what team I was on? *coughspointstodefaultuserpiccoughs*  I ended up not thinking up as many as I would have liked--and sadly, thought up one or two after it had closed >.<.  But, I hope everyone enjoys the ones I did come up with!
~0~0~"Every Sunday Night"It was common knowledge throughout Crowley's minions that he disappeared every Sunday night, at seven. But no one knew why. Of course, there were many theories, mostly involving kinky sex, or torturing the Winchesters. But to be honest, no one could've ever have guessed the truth.

Settled in his study, Craig in hand, Crowley grinned at the show's opening sequence. This time, it featured zombies in its Enchanted Forest trees. Once Upon a time never disappointed. Well, he knew of one improvement necessary. Taking a sip of his scotch, he sighed, "I hope this episode has some Rumbelle in it."


"Crowley's a Horny SOB"

Crowley quickly snuffed the candle, shoving away the items as he saw her—obviously distressed—returning to their table.

"My dear," he said, concern dripping from honeyed tones, "whatever's the matter?"

Jody took a shaky seat across from him, quick to dismiss what had just happened.


"Are you quite sure? Perhaps we should call it a night?"

"No!" she smiled, adding, "No. I'm fine. I swear."

Crowley arched a brow, a suggestive twinkle in his eye. "Then, perhaps we should move this date… elsewhere?"

Returning his look full-force, Jody nodded. A bird in t...
Posted: 17 Jun 13 19:45 • More • Comments
Yup, I've done it again.  So, here it is, folks, under the cut.  Some of these will require some deep thinking on my part... while others might come a bit too easily....

group support trapped between realities wings headaches / migraines body image issues surprise sexswap sex pollen sexual extortion cages theft fighting forced to rely on enemy / rival WILD CARD amnesia stalkers severe / life-threatening illness surgery blackmail family telepathic trauma fall from grace making deals with demons food poisoning poltergeist exhaustion
Posted: 13 Jun 13 11:17 • Comments
Title: I'll Be Dead Before the Day is Done

Creator: Patriciatepes

Fandom: Supernatural

Pairing(s): Crowley/Meg/Fake!Castiel, as well as references to Meg/Real!Castiel hopefulness

Rating: NC-17

Work Type (fic, art): Fic

Word Count: ~11,800

Work URL: Part I

Summary: Set in between SPN Seasons 7 and 8. When Crowley took Meg back home, he decided that he would torture her with everything he could imagine… and when Meg finally reveals some personal information, Crowley uses it to his advantage.

Prompt: Bingo square used from Illustrationkink_bingo, erotic torture

Perversities (Kinks, concepts): Torture, knifeplay, bloodplay, language, non-con, dub-con, some drowning type torture, bestiality very lightly described in past tense, various way to inflict pain both emotionally and physically, oral sex, anal sex, fisting, rimming, sexual congress with wounds very lightly described in past tense, masturbation, voyeurism

Warnings: Light spoilers for SPN Season 8, but nothing major, non-con, dub-con, torture, knifeplay, bloodplay, bestiality (lightly described in the past), sexual congress with wounds (very lightly described in past tense)

Author Notes: Title taken from the Florence + the Machine song, "Seven Devils."

Part II

Being the son of a witch, Crowley knew a few extra tricks that most demons did not. And it was to these tricks that he was turning to now in his study. Jerking off on top of his little pet had clearl...
Posted: 12 Jun 13 17:56 • More • Comments
Title: I'll Be Dead Before the Day is Done

Creator: Patriciatepes

Fandom: Supernatural

Pairing(s): Crowley/Meg/Fake!Castiel, as well as references to Meg/Real!Castiel hopefulness

Rating: NC-17

Work Type (fic, art): Fic

Word Count: ~11,800

Work URL: Part II

Summary: Set in between SPN Seasons 7 and 8. When Crowley took Meg back home, he decided that he would torture her with everything he could imagine… and when Meg finally reveals some personal information, Crowley uses it to his advantage.

Prompt: Bingo square used from Illustrationkink_bingo, erotic torture

Perversities (Kinks, concepts): Torture, knifeplay, bloodplay, language, non-con, dub-con, some drowning type torture, bestiality very lightly described in past tense, various way to inflict pain both emotionally and physically, oral sex, anal sex, fisting, rimming, sexual congress with wounds very lightly described in past tense, masturbation, voyeurism

Warnings: Light spoilers for SPN Season 8, but nothing major, non-con, dub-con, torture, knifeplay, bloodplay, bestiality (lightly described in the past), sexual congress with wounds (very lightly described in past tense)

Author Notes: Title taken from the Florence + the Machine song, "Seven Devils."

I'll be Dead Before the Day is Done

Part I

Hell was not much different under Crowley's rule. To be honest, Meg had not been sure what she had expected to be so different. Was she expecting less screami...
Posted: 12 Jun 13 17:52 • More • Comments
Author Name: Patriciatepes (Patricia de Lioncourt )

Fandom: Supernatural

Rating: PG-13 (for Now)

Characters: Daphne Allen, Crowley, Castiel, Meg, Dean, Sam, Kevin Tran, and necessary OCs

Pairing: Crowley/Daphne, Castiel/Meg, past Daphne/Castiel

Chapter Links: Prev | Next

Warnings: Hints of torture, sexual situations, light torture… more might be added later depending on how dark I want to take this

Summary: AU Past Parts of SPN S8. Daphne Allen is a saint… and saints are rare creatures. Saints have many powers, useful to both angels… and to demons. Saints can hear the angels speak, their blood can be used for many things, and they have a sight for things that normal humans do not. And, more importantly, saints have the power to redeem a soul. In order to ensure her family's safety, Daphne makes a deal with Crowley—one year of usage of her saintly powers with no arguments, and no interferences.

Disclaimer: I don't own Supernatural or any related characters. They belong to Kripke. No money made here.

Author's Notes: Just a couple of things here right off the bat. First off, I will have multiple points of view. However, for the majority of the fic, it will be through Daphne's eyes. Also, I did a Hard R-rated fic that had a similar setting to this one… what can I say? I just love this setting. But I'll be spanning this one's view out a little bit more. Also, I know this chapter is a bit long… but I had to cover the flashback. I know that it could've been a story in and of itself, but I feel that the rest of this story is the more interesting bit. And the rating may rise in later chapters....
Posted: 26 May 13 10:54 • More • Comments
Artist: Illustrationlylithj2
Recipient: Illustrationgryphon2k
Original Prompt: Crowley holds a screening of a horror movie—the Exorcist, Paranormal Activity, for examples—and spends the whole time mocking it (think Mystery Science Theater if you are familiar with it). Other guests are up to you...
Title: We Might Die… So, Movie Night
Words: ~1900
Rating: PG-13
Warnings: Spoilers for the 3rd Paranormal Activity
Disclaimer: I don't own Supernatural or any related characters. All belongs to Kripke.
Synopsis: Set in SPN S7. It's the night before the group decides to take on Dick Roman, and Castiel knows just how they should spend it… whether the others wanted to or not.
Author's Notes: So, just a tiny bit of crack. I hope that everyone finds this amusing… and no offense meant to those who like the Paranormal Activity movies… the opinions that Crowley expresses are Crowley's, not mine.  Written for the Illustrationspn_bigpretzel Spring Exchange challenge.

We Might Die… So, Movie Night

Posted: 13 May 13 13:04 • More • Comments
Title: Letters to the North Pole
Fandom: Supernatural
Rating: PG-13
Characters: Weechester Dean, Weechester Sam, John, Santa
Warnings: Some light sad moments, but they are followed by sweetness and good, I promise
Prompt by: phebemarie
Summary: A disappointed Dean does the only thing he can think to do to make sure that his dad is done with his hunt by Christmas… he writes to Santa. Of course, the response he gets is anything but expected.
Disclaimer: I don't own Supernatural or any related characters. SPN belongs to Kripke. No money made here. Art by the wonderful Illustrationprincess_schez
Author's Notes: Written for Illustrationspn_bigpretzel's Secret Satan Exchange. My first Weechester fic, so please be kind. You know, I don't write a lot of fanfic based around or on holidays… I don't know why. I love holidays—Halloween, Christmas… heck, I even enjoy Independence Day. Well, anyhow, I hope everyone enjoys this fic, and I hope Illustrationphebemarie enjoys what I've written for her! Happy holidays! (Note: So, obviously, this is really, really late on my own LJ.  Sorry about that... crap happened in RL.  But I think I'm officially all caught up on my *new* postings here on LJ....
Posted: 23 Apr 13 12:47 • More • Comments
Author Name: Patriciatepes (Patricia de Lioncourt )

Fandom: Supernatural

Rating: PG-13 (for Now)

Characters: Daphne Allen, Crowley, Castiel, Meg, Dean, Sam, Kevin Tran, and necessary OCs

Pairing: Crowley/Daphne, Castiel/Meg, past Daphne/Castiel

Chapter Links: Prev | Next

Warnings: Hints of torture, sexual situations, light torture… more might be added later depending on how dark I want to take this

Summary: AU Past Parts of SPN S8. Daphne Allen is a saint… and saints are rare creatures. Saints have many powers, useful to both angels… and to demons. Saints can hear the angels speak, their blood can be used for many things, and they have a sight for things that normal humans do not. And, more importantly, saints have the power to redeem a soul. In order to ensure her family's safety, Daphne makes a deal with Crowley—one year of usage of her saintly powers with no arguments, and no interferences.

Disclaimer: I don't own Supernatural or any related characters. They belong to Kripke. No money made here.

Author's Notes: Just a couple of things here right off the bat. First off, I will have multiple points of view. However, for the majority of the fic, it will be through Daphne's eyes. Also, I did a Hard R-rated fic that had a similar setting to this one… what can I say? I just love this setting. But I'll be spanning this one's view out a little bit more. Also, I know this chapter is a bit long… but I had to cover the flashback. I know that it could've been a story in and of itself, but I feel that the rest of this story is the more interesting bit. And the rating may rise in later chapters.  Also, I'm still way behind on posting things here on LJ... I...
Posted: 23 Apr 13 12:24 • More • Comments

Art made for angstbigbang for No Excuse for the State I'm in by Illustrationagirlnamedtruth
Link to the story: HERE
Story Summary: Some of the memories Severus couldn’t show Harry. An exploration of Severus and Lily’s somewhat unhealthy on/off relationship and events that push him into becoming a Death Eater and inadvertently causing her death.
Disclaimer: I do not own Harry Potter or any of the screencaps or promo pictures used in this manip. Other images were found in a google image search.  Stock images by LadyAmdis.Illustration

Posted: 17 Apr 13 13:08 • Comments
A very happy birthday to my very best friend, Twisted_Slinky!  I hope she really enjoys the icons I made for her!


Posted: 3 Apr 13 18:56 • Comments
Yes, yet another bingo.  But, I really like the card I got.  I can't wait to see what I can use these prompts for. *rubs hands together*  I've already got a couple of mini-level bangs that I intend to use this card as inspiration for.







Anonymous Sex



Erotic Torture

First Time


Knives/Knife Play

Hair Fetishization





Power Struggle




Posted: 29 Mar 13 18:24 • More • Comments
I'm crazy.  So... so nuts.  But I've decided that I'll only aim for one line bingos on all the bingos I have open.  And I intend to sign up for the Kink Bingo. *Le Sigh*  Anyhow, if you should like to take a peek at my love bingo and have any idea as to something you'd like to see for the prompts, drop me a line!  Also, I know I've been quiet on my own journal as of late.  I've got a couple of stories I still have to add here from last year... I'm trying to play catch-up.  More on that later.

Posted: 23 Mar 13 15:57 • Comments
I'm behind posting on my journal... I've got at least one story to put up here that hasn't been put up yet.  And that's not to mention what I should be working on/posting on at  So what am I doing?  A meme!

Give me a fandom and I'll fill out the below;

Favorite character(s):
Favorite Pairing(s):
Least Favorite Character(s):
Least Favorite Pairing(s):
I pity/feel sorry for:
I'd be best friends with:
Go shopping with:
Karaoke with:
Who would I kill:
Who would I tango with:
Which 4 characters would I want to be stuck in a zombie apocalypse with:
Who would I sleep with:
Who would I kiss:
Who would I share an umbrella with:
Spend my last moments with:
Bake a cake for:
Take Over the World with:

Fandoms can include but are not limited to: Supernatural, The Vampire Diaries, Merlin, Darkwing Duck, Batman (any), Buffy the Vampire Slayer, Angel the Series, Forever Knight, Castlevania, Vampire Hunter D ...or anything else I've seen (see tag list on this post for ideas). Meme grabbed from Illustrationagirlnamedtruth
Posted: 25 Jan 13 08:25 • Comments
Illustrationvillainbigbang Illustrationvillainbigbang Illustrationvillainbigbang

A Big Bang for Baddies You Love and Hate.

There will be two options for this challenge.
1. Big Bang: 15,000 word minimum
2. Mini Bang: 5,000 word minimum

January 20th: Author & Artist Sign Ups Open
March 1st: Reminder Artist Sign Ups
March 20th: Check-In #1
April 25th: Author Sign Ups close + Rough Drafts Due
April 27th: Artist Claiming!
May 30th: Author & Artist Check In #2
June 15th: Check-In #3
June 30th: Final Draft Posting

FAQ | Author Sign Ups | Artist Sign Ups
Posted: 20 Jan 13 08:26 • Comments
I have a problem, seriously.  This is the 4th bingo I'm participating in... and I know that there is at least one more I'm gonna sign up for when it opens.  But, for now... here's my Illustrationhomebrewbingo card under the cut.

coming in/on partnerweapon fetishizationharems/ seragliosmusicsnarktempermental personalitiesintelligencesports themes & fetishizationstripteasebondagewashingjewelryWILD CARD asexualityrescueprotectivenessrestraintbitingbody swapice princesses & snow queensvampiresgetawaysface-sittingfuck or diegags
Posted: 10 Dec 12 15:00 • Comments